Dmd066829 227..237
نویسندگان
چکیده
The human mitochondrial cytochrome P450 enzymes CYP11A1, CYP11B1, and CYP11B2 are involved in the biosynthesis of steroid hormones.CYP11A1 catalyzes the side-chain cleavageof cholesterol, and CYP11B1 and CYP11B2 catalyze the final steps in the biosynthesis of glucoand mineralocorticoids, respectively. This study reveals their additional capability tometabolize the xenobiotic steroid oral turinabol (OT; 4-chlor-17b-hydroxy-17a-methylandrosta-1,4dien-3-on),which is a commondoping agent. By contrast,microsomal steroid hydroxylases did not convert OT. Spectroscopic binding assays revealed dissociation constants of 17.7 mM and 5.4 mM for CYP11B1 and CYP11B2, respectively, whereas no observable binding spectra emerged forCYP11A1.Catalytic efficienciesofOTconversion were determined to be 46min mM for CYP11A1, 741min mM for CYP11B1, and 3338 min mM for CYP11B2, which is in the same order of magnitude as for the natural substrates but shows a preference of CYP11B2 for OT conversion. Products of OT metabolismby the CYP11B subfamily members were produced at amilligram scale with a recombinant Escherichia coli–based whole-cell system. They were identified by nuclear magnetic resonance spectroscopy to be 11b-OH-OT for both CYP11B isoforms, whereby CYP11B2 additionally formed 11b,18-diOH-OT and 11b-OH-OT-18-al, which rearranges to its tautomeric form 11b,18-expoxy-18-OH-OT. CYP11A1 produces six metabolites, which are proposed to include 2-OH-OT, 16-OH-OT, and 2,16-diOH-OT based on liquid chromatography–tandem mass spectrometry analyses. All three enzymes are shown to be inhibited by OT in their natural function. The extent of inhibition thereby depends on the affinity of the enzyme for OT and the strongest effect was demonstrated for CYP11B2. These findings suggest that steroidogenic cytochrome P450 enzymes can contribute to drug metabolism and should be considered in drug design and toxicity studies.
منابع مشابه
Effects of Muscarinic Acetylcholine 3 Receptor208-227 Peptide Immunization on Autoimmune Response in Nonobese Diabetic Mice
The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205-237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certain autoimmune disorders, including Sjögren's syndrome (SS). Autoantibodies against M3R(228-237) have been shown to interfere with the function of M3R. However, few studies have been performed on the...
متن کاملUpdate 1 of: Protection (and Deprotection) of Functional Groups in Organic Synthesis by Heterogeneous Catalysis.
2.7. Redox Deprotections 221 3. Thiol Protecting Groups 223 4. Carboxy Protecting Groups 223 4.1. Protection 224 4.2. Deprotection 226 5. Carbonyl Protecting Groups 227 5.1. Acetals 227 5.1.1. Protection 227 5.1.2. Deprotection 231 5.2. Dithioacetals 233 5.2.1. Protection 233 5.2.2. Deprotection 235 5.3. 1,3-Oxathiolanes 237 5.4. 1,1-Diacetates (Acylals) 238 5.4.1. Protection 238 5.4.2. Deprote...
متن کاملExtrachromosomal inheritance in bacteria.
INTRODUCTION............................................................ 211 Definitions.................................................................. 211 Overall Genetic Organization of aPlasmid. 212 RECOGNITION AND IDENTIFICATION OF EXTRACHROMOSOMAL ELEIMENTS............................................................. 212 Lack of Genetic Linkage to Chromosome................................
متن کاملErratum : A Geometrical Theory of Jacobi Forms of Higher Degree
Erratum : A Geometrical Theory of Jacobi Forms of Higher Degree Jae-Hyun Yang Department of Mathematics, Inha University, Incheon 402-751, Korea e-mail : [email protected] Erratum In the article A Geometrical Theory of Jacobi Forms of Higher Degree by JaeHyun Yang [Kyungpook Math. J., 40(2)(2000), 209-237], the author presents the Laplace-Beltrami operator ∆g,h of the Siegel-Jacobi space (Hg,h,...
متن کاملPARAQUAT First draft prepared
Explanation.................................................................................................... 203 Evaluation for acceptable daily intake .......................................................... 204 Biochemical aspects ................................................................................ 204 Absorption, distribution and excretion ......................................
متن کامل